PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000803.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 446aa    MW: 50127.7 Da    PI: 6.2479
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000803.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.71.5e-55101391129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL+ k    ++e++ewyfFs++dkky+tg+r+nrat +g+W
  Itr_sc000803.1_g00008.1  10 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQdKcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFW 94 
                              69****************************.9***************943432233667*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk+v++ k +l+g++ktLvfykgrap+g+ktdW+mheyrle
  Itr_sc000803.1_g00008.1  95 KATGRDKAVYD-KAKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 139
                              ***********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-596174IPR003441NAC domain
PROSITE profilePS5100558.95510174IPR003441NAC domain
PfamPF023657.0E-2911138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MDTADESCTV PPGFRFHPTD EELVGYYLRK KVASQKIDLD VIRDIDLYRI EPWDLQDKCR  60
IGYEEQNEWY FFSHKDKKYP TGTRTNRATM AGFWKATGRD KAVYDKAKLI GMRKTLVFYK  120
GRAPNGQKTD WIMHEYRLES EENGPPQASS IPFIHFLLHS SQEEGWVVCR AFKKRITGQA  180
KSMEGWESNF LYDEPNINNM DYMTRQAAAA APSNFMAAQT FLCKQELEAS ENLTFMHADQ  240
LFNQLPQLQS PSLPLLKTPL LQENHRSNAT EDTAGEQIKN NINCVSNKKV TDWRALDKFV  300
ASQLSHDVNQ ESFEDHGCDE MGSLLLLQSE MRDNAGGGGS GGRLNDFLSS GSSECDNIGN  360
LVVDPWSRDR AAIAEPSHDH GSVRTGRFEP NRHCSNRNRN RTVGSGSGIG SGDSGTGTAG  420
SEPEPPVPNR NRTVPNRNRT VPVPEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-4941759169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00471DAPTransfer from AT4G36160Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046736.11e-158Vascular related NAC-domain protein 1 isoform 2
SwissprotO655081e-136NAC76_ARATH; NAC domain-containing protein 76
TrEMBLA0A061DLN41e-158A0A061DLN4_THECC; Vascular related NAC-domain protein 1 isoform 2
STRINGVIT_04s0023g03110.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.11e-124NAC domain containing protein 76